Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ube2z Rabbit Polyclonal Antibody (Biotin)

Ube2z Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGD1308347

UniProt

Q3B7D1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ube2z

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001032732

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Uncharacterized protein CXorf65, CXorf65 ELISA Kit
MBS9334123-01 48 Well

Human Uncharacterized protein CXorf65, CXorf65 ELISA Kit

Sign In for Pricing
View Details
Human Uncharacterized protein CXorf65, CXorf65 ELISA Kit
MBS9334123-02 96 Well

Human Uncharacterized protein CXorf65, CXorf65 ELISA Kit

Sign In for Pricing
View Details
Human Uncharacterized protein CXorf65, CXorf65 ELISA Kit
MBS9334123-03 5x 96 Well

Human Uncharacterized protein CXorf65, CXorf65 ELISA Kit

Sign In for Pricing
View Details
Human Uncharacterized protein CXorf65, CXorf65 ELISA Kit
MBS9334123-04 10x 96 Well

Human Uncharacterized protein CXorf65, CXorf65 ELISA Kit

Sign In for Pricing
View Details
Anti-SERCA1 ATPase/ATP2A1 Antibody Picoband® (Dylight550 Conjugate)
RP1053-Dylight550 100 µg

Anti-SERCA1 ATPase/ATP2A1 Antibody Picoband® (Dylight550 Conjugate)

Sign In for Pricing
View Details
NANOG, NT (NANOG, Homeobox protein NANOG, Homeobox transcription factor Nanog) (MaxLight 750)
MBS6323702-01 0.1 mL

NANOG, NT (NANOG, Homeobox protein NANOG, Homeobox transcription factor Nanog) (MaxLight 750)

Sign In for Pricing
View Details