Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ube2z Rabbit Polyclonal Antibody (HRP)

Ube2z Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1308347

UniProt

Q3B7D1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ube2z

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001032732

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEK1, NT (MAPK/ERK Kinase 1, MEK 1, Dual Specificity Mitogen-Activated Protein Kinase Kinase 1, MAP Kinase Kinase 1, MAP2K1, MAPKK 1, MKK1, PRKMK1, ERK Activator Kinase 1) discontinued
M2865-12W 50 µg

MEK1, NT (MAPK/ERK Kinase 1, MEK 1, Dual Specificity Mitogen-Activated Protein Kinase Kinase 1, MAP Kinase Kinase 1, MAP2K1, MAPKK 1, MKK1, PRKMK1, ERK Activator Kinase 1) discontinued

Sign In for Pricing
View Details
(2,6-difluorophenyl) -N- (6-ethoxybenzothiazol-2-yl) formamide
BUA27740 250 mg

(2,6-difluorophenyl) -N- (6-ethoxybenzothiazol-2-yl) formamide

Sign In for Pricing
View Details
Hsa-miR-1250-3p miRNA Inhibitor
CIH2096-01 10 nmol

Hsa-miR-1250-3p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-1250-3p miRNA Inhibitor
CIH2096-02 20 nmol

Hsa-miR-1250-3p miRNA Inhibitor

Sign In for Pricing
View Details
CAT1/SLC7A1 Rabbit Polyclonal Antibody (Cy3)
orb2574541 100 µg

CAT1/SLC7A1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
MhpD Antibody
orb821497 2 mg

MhpD Antibody

Sign In for Pricing
View Details