Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR46 Rabbit Polyclonal Antibody (FITC)

WDR46 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

UTP7, BING4, FP221, C6orf11

UniProt

O15213

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human WDR46

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VDVISLEQGKKEQIERLGYDPQAKAPFQPKPKQKGRSSTASLVKRKRKVM

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005443

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Monoclonal Anti- TPX2 antibody
BRM1120-2 100 µL

Recombinant Monoclonal Anti- TPX2 antibody

Sign In for Pricing
View Details
Recombinant Anti-Dia 1 Rabbit mAb
CMA4347-01 30 µL

Recombinant Anti-Dia 1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Dia 1 Rabbit mAb
CMA4347-02 50 μL

Recombinant Anti-Dia 1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Dia 1 Rabbit mAb
CMA4347-03 100 µL

Recombinant Anti-Dia 1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Dia 1 Rabbit mAb
CMA4347-04 200 µL

Recombinant Anti-Dia 1 Rabbit mAb

Sign In for Pricing
View Details
ETV7 (Transcription Factor ETV7, ETS Translocation Variant 7, ETS-related Protein Tel2, Tel-related Ets Factor, Transcription Factor Tel-2, TEL2, TELB, TREF) (MaxLight 405) discontinued
126487-ML405 100 µL

ETV7 (Transcription Factor ETV7, ETS Translocation Variant 7, ETS-related Protein Tel2, Tel-related Ets Factor, Transcription Factor Tel-2, TEL2, TELB, TREF) (MaxLight 405) discontinued

Sign In for Pricing
View Details