Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR19 Rabbit Polyclonal Antibody (Biotin)

GPR19 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q15760

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LNLLFLLSWLPFHVAQLWHPHEQDYKKSSLVFTAITWISFSSSASKPTLY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006134

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS-5 Inhibitor
C01323-5mg 5 mg

ADAMTS-5 Inhibitor

Sign In for Pricing
View Details
MEF2BNB Antibody
orb380124 100 µL

MEF2BNB Antibody

Sign In for Pricing
View Details
IER3 ORF Vector (Human) (pORF)
ORF021341 1.0 µg DNA

IER3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ATG4A (ATG4A, APG4A, AUTL2, Cysteine protease ATG4A, AUT-like 2 cysteine endopeptidase, Autophagin-2, Autophagy-related cysteine endopeptidase 2, Autophagy-related protein 4 homolog A) (MaxLight 550) discontinued
032191-ML550 100 µL

ATG4A (ATG4A, APG4A, AUTL2, Cysteine protease ATG4A, AUT-like 2 cysteine endopeptidase, Autophagin-2, Autophagy-related cysteine endopeptidase 2, Autophagy-related protein 4 homolog A) (MaxLight 550) discontinued

Sign In for Pricing
View Details
P16INK4a Antibody / CDKN2A
V5280-20UG 20 µg

P16INK4a Antibody / CDKN2A

Sign In for Pricing
View Details
Transmembrane Protease Serine 11A, Recombinant, Human, aa40-421, His-Tag
586584 20 µg

Transmembrane Protease Serine 11A, Recombinant, Human, aa40-421, His-Tag

Sign In for Pricing
View Details