Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR19 Rabbit Polyclonal Antibody (HRP)

GPR19 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q15760

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNLLFLLSWLPFHVAQLWHPHEQDYKKSSLVFTAITWISFSSSASKPTLY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006134

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pus3 ORF Vector (Mouse) (pORF)
ORF055305 1.0 µg DNA

Pus3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Gucy1b3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6864808 1.0 µg DNA

Gucy1b3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Lentiviral human ACOT4 shRNA (UAS) - Lentiviral human ACOT4 shRNA (UAS) plasmid
GTR15126271 1 Vial

Lentiviral human ACOT4 shRNA (UAS) - Lentiviral human ACOT4 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Human TGFbR1 (Transforming Growth Factor Beta Receptor I) ELISA Kit
EK240954 96 Well

Human TGFbR1 (Transforming Growth Factor Beta Receptor I) ELISA Kit

Sign In for Pricing
View Details
Picalm sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7020705 3x 1.0 µg

Picalm sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
GLP/GOLGA6 Antibody
orb20348 100 µg

GLP/GOLGA6 Antibody

Sign In for Pricing
View Details