Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-A Rabbit Polyclonal Antibody (HRP)

HLA-A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HLAA

UniProt

P01892

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human HLA-A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-RANK antibody
SL2695R-01 50 µL

Rabbit Anti-RANK antibody

Sign In for Pricing
View Details
Rabbit Anti-RANK antibody
SL2695R-02 100 µL

Rabbit Anti-RANK antibody

Sign In for Pricing
View Details
IL18RAP, NT (CD218b, CDw218b, CD218 Antigen-like Family Member B, Interleukin-1 Receptor 7, IL-1R-7, IL-1R7, Accessory Protein-like, AcPL, IL-1R Accessory Protein-like, IL-1RAcPL, Interleukin-18 Receptor beta, IL-18R-beta, IL-18Rbeta, Interleukin-18 Recep
MBS6483213-01 0.1 mL

IL18RAP, NT (CD218b, CDw218b, CD218 Antigen-like Family Member B, Interleukin-1 Receptor 7, IL-1R-7, IL-1R7, Accessory Protein-like, AcPL, IL-1R Accessory Protein-like, IL-1RAcPL, Interleukin-18 Receptor beta, IL-18R-beta, IL-18Rbeta, Interleukin-18 Recep

Sign In for Pricing
View Details
IL18RAP, NT (CD218b, CDw218b, CD218 Antigen-like Family Member B, Interleukin-1 Receptor 7, IL-1R-7, IL-1R7, Accessory Protein-like, AcPL, IL-1R Accessory Protein-like, IL-1RAcPL, Interleukin-18 Receptor beta, IL-18R-beta, IL-18Rbeta, Interleukin-18 Recep
MBS6483213-02 5x 0.1 mL

IL18RAP, NT (CD218b, CDw218b, CD218 Antigen-like Family Member B, Interleukin-1 Receptor 7, IL-1R-7, IL-1R7, Accessory Protein-like, AcPL, IL-1R Accessory Protein-like, IL-1RAcPL, Interleukin-18 Receptor beta, IL-18R-beta, IL-18Rbeta, Interleukin-18 Recep

Sign In for Pricing
View Details
NTE (PNPLA6) (NM_001166113) Human Tagged Lenti ORF Clone
RC229073L4 10 µg

NTE (PNPLA6) (NM_001166113) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Platelet Factor-4 (Human, 58-70)
MDP0677 500 µg

Platelet Factor-4 (Human, 58-70)

Sign In for Pricing
View Details