Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRI Rabbit Polyclonal Antibody (Biotin)

SRI Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SCN, V19, CP22, CP-22

UniProt

P30626

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003121

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propylamine hydrochloride
FN76683 0.05 g

N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propylamine hydrochloride

Sign In for Pricing
View Details
Lentiviral mouse Mrgprd shRNA (UAS) - Lentiviral mouse Mrgprd shRNA (UAS, iRFP) plasmid
GTR15234664 1 Vial

Lentiviral mouse Mrgprd shRNA (UAS) - Lentiviral mouse Mrgprd shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Anti-Laminin subunit gamma-2 LAMC2 Antibody Picoband®, Carrier-free
PA1582-carrier-free 100 µg/Vial

Anti-Laminin subunit gamma-2 LAMC2 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Sf3b3 3'UTR GFP Stable Cell Line
TU270226 1.0 mL

Sf3b3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human NKAIN4 Protein Lysate
MBS8416048-01 0.02 mg

Human NKAIN4 Protein Lysate

Sign In for Pricing
View Details
Human NKAIN4 Protein Lysate
MBS8416048-02 5x 0.02 mg

Human NKAIN4 Protein Lysate

Sign In for Pricing
View Details