Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRI Rabbit Polyclonal Antibody (FITC)

SRI Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SCN, V19, CP22, CP-22

UniProt

P30626

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003121

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLP2 antibody - middle region (ARP45348_T100)
ARP45348_T100 100 µL

PLP2 antibody - middle region (ARP45348_T100)

Sign In for Pricing
View Details
Canine Zinc Finger Protein Eos (IKZF4) ELISA Kit
MBS9940588-01 48 Well

Canine Zinc Finger Protein Eos (IKZF4) ELISA Kit

Sign In for Pricing
View Details
Canine Zinc Finger Protein Eos (IKZF4) ELISA Kit
MBS9940588-02 96 Well

Canine Zinc Finger Protein Eos (IKZF4) ELISA Kit

Sign In for Pricing
View Details
Canine Zinc Finger Protein Eos (IKZF4) ELISA Kit
MBS9940588-03 5x 96 Well

Canine Zinc Finger Protein Eos (IKZF4) ELISA Kit

Sign In for Pricing
View Details
Canine Zinc Finger Protein Eos (IKZF4) ELISA Kit
MBS9940588-04 10x 96 Well

Canine Zinc Finger Protein Eos (IKZF4) ELISA Kit

Sign In for Pricing
View Details
Slc35e4 (NM_153316) Rat Tagged ORF Clone Lentiviral Particle
RR203847L4V 200 µL

Slc35e4 (NM_153316) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details