Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubb Rabbit Polyclonal Antibody (FITC)

Ubb Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ubc, Ubb2, Uba52, Rps27a, AL033289

UniProt

Q78XY9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035794

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCR4-TOPO-TEX49 Plasmid
PVT30855 2 µg

pCR4-TOPO-TEX49 Plasmid

Sign In for Pricing
View Details
Olr198 Protein Vector (Rat) (pPB-N-His)
PV289271 500 ng

Olr198 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
DLX1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
18295154 3x 1.0 µg DNA

DLX1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Nectin-3/PVRL3 Overexpression Lysate (Native) - (Dry Ice)
NBL1-15007 0.1 mg

Nectin-3/PVRL3 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
MANEA Rabbit pAb, Pacific Blue conjugated
orb2827047 100 µL

MANEA Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Pack of 100 Blotting Paper 110G/M², 250X250 Mm
PB110F2525C Pack of 100

Pack of 100 Blotting Paper 110G/M², 250X250 Mm

Sign In for Pricing
View Details