Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubb Rabbit Polyclonal Antibody (FITC)

Ubb Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ubc, Ubb2, Uba52, Rps27a, AL033289

UniProt

Q78XY9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035794

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ZNF19 Protein - (Dry Ice)
H00007567-P01-10ug 10 µg

Recombinant Human ZNF19 Protein - (Dry Ice)

Sign In for Pricing
View Details
GENLISA™ Human Claudin 8 (CLDN8) ELISA
KBH2306 96 Well

GENLISA™ Human Claudin 8 (CLDN8) ELISA

Sign In for Pricing
View Details
EPOR Rabbit Polyclonal Antibody (BF594)
orb1592540 100 µL

EPOR Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Fgf17 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6774604 1.0 µg DNA

Fgf17 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Anti-PDK3 Antibody Picoband®, Cy3 Conjugate
A05658-1-Cy3 100 µg/Vial

Anti-PDK3 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Gm867 Mouse siRNA Oligo Duplex (Locus ID 333670)
SR401048 1 Kit

Gm867 Mouse siRNA Oligo Duplex (Locus ID 333670)

Sign In for Pricing
View Details