Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD80 Rabbit Polyclonal Antibody (HRP)

CD80 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B7, BB1, B7-1, B7.1, LAB7, CD28LG, CD28LG1

UniProt

P33681

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCF

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_005182

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPHX2 Rabbit Polyclonal Antibody
orb626770-01 50 µg

EPHX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EPHX2 Rabbit Polyclonal Antibody
orb626770-02 100 µg

EPHX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cdc7 Mouse Pre-designed siRNA Set A
HY-RS16741 1 Set

Cdc7 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse ADP-ribosylation factor-like protein 16 (ARL16) ELISA Kit
MBS7248003-01 48 Well

Mouse ADP-ribosylation factor-like protein 16 (ARL16) ELISA Kit

Sign In for Pricing
View Details
Mouse ADP-ribosylation factor-like protein 16 (ARL16) ELISA Kit
MBS7248003-02 96 Well

Mouse ADP-ribosylation factor-like protein 16 (ARL16) ELISA Kit

Sign In for Pricing
View Details
Mouse ADP-ribosylation factor-like protein 16 (ARL16) ELISA Kit
MBS7248003-03 5x 96 Well

Mouse ADP-ribosylation factor-like protein 16 (ARL16) ELISA Kit

Sign In for Pricing
View Details