Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPS Rabbit Polyclonal Antibody (Biotin)

NPS Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

P0C0P6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFL

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001025184

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spring clamp SC for 250ml flask
BAT1124 1 Each

Spring clamp SC for 250ml flask

Sign In for Pricing
View Details
VEGF Receptor 1 (Flt1, VEGFR1, Vascular Endothelial Growth Factor Receptor 1)
V2110-16F1 50 µg

VEGF Receptor 1 (Flt1, VEGFR1, Vascular Endothelial Growth Factor Receptor 1)

Sign In for Pricing
View Details
Bod1 Rat shRNA Plasmid (Locus ID 287173)
TR701997 1 Kit

Bod1 Rat shRNA Plasmid (Locus ID 287173)

Sign In for Pricing
View Details
Hamster Basic Salivary Proline Rich Protein 1 ELISA Kit
MBS077240-01 48 Well

Hamster Basic Salivary Proline Rich Protein 1 ELISA Kit

Sign In for Pricing
View Details
Hamster Basic Salivary Proline Rich Protein 1 ELISA Kit
MBS077240-02 96 Well

Hamster Basic Salivary Proline Rich Protein 1 ELISA Kit

Sign In for Pricing
View Details
Hamster Basic Salivary Proline Rich Protein 1 ELISA Kit
MBS077240-03 5x 96 Well

Hamster Basic Salivary Proline Rich Protein 1 ELISA Kit

Sign In for Pricing
View Details