Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1RN Rabbit Polyclonal Antibody (FITC)

IL1RN Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DIRA, IRAP, IL1F3, IL1RA, MVCD4, IL-1RN, IL-1ra, IL-1ra3, ICIL-1RA

UniProt

Q53SC2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ADLYEEGGGGGGEGEDNADSKETICRPSGRKSSKMQAFRIWDVNQKTFYL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_776213

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Receptor I For The Fc Region Of Immunoglobulin G (FcgammaRI) ELISA Kit
MBS2611332-01 48 Well

Canine Receptor I For The Fc Region Of Immunoglobulin G (FcgammaRI) ELISA Kit

Sign In for Pricing
View Details
Canine Receptor I For The Fc Region Of Immunoglobulin G (FcgammaRI) ELISA Kit
MBS2611332-02 96 Well

Canine Receptor I For The Fc Region Of Immunoglobulin G (FcgammaRI) ELISA Kit

Sign In for Pricing
View Details
Canine Receptor I For The Fc Region Of Immunoglobulin G (FcgammaRI) ELISA Kit
MBS2611332-03 5x 96 Well

Canine Receptor I For The Fc Region Of Immunoglobulin G (FcgammaRI) ELISA Kit

Sign In for Pricing
View Details
Canine Receptor I For The Fc Region Of Immunoglobulin G (FcgammaRI) ELISA Kit
MBS2611332-04 10x 96 Well

Canine Receptor I For The Fc Region Of Immunoglobulin G (FcgammaRI) ELISA Kit

Sign In for Pricing
View Details
HHLA2 Antibody (FITC)
orb517616-01 50 µg

HHLA2 Antibody (FITC)

Sign In for Pricing
View Details
HHLA2 Antibody (FITC)
orb517616-02 100 µg

HHLA2 Antibody (FITC)

Sign In for Pricing
View Details