Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1RN Rabbit Polyclonal Antibody (HRP)

IL1RN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DIRA, IRAP, IL1F3, IL1RA, MVCD4, IL-1RN, IL-1ra, IL-1ra3, ICIL-1RA

UniProt

Q53SC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ADLYEEGGGGGGEGEDNADSKETICRPSGRKSSKMQAFRIWDVNQKTFYL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_776213

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4EBP1 antibody
70R-51528 100 µL

4EBP1 antibody

Sign In for Pricing
View Details
Mouse Ece1 (NM_199307) AAV Particle
MR210476A1V 250 µL

Mouse Ece1 (NM_199307) AAV Particle

Sign In for Pricing
View Details
BAIAP2 (Brain-specific Angiogenesis Inhibitor 1-associated Protein 2, BAI1-associated Protein 2, BAI-associated Protein 2, Protein BAP2, Insulin Receptor Substrate Protein of 53kD, Insulin Receptor Substrate p53, IRSp53, Insulin Receptor Substrate p53/p58, IRSp53/58, IRS-58, Fas Ligand-associated Factor 3, FLAF3) (FITC)
123819-FITC 100 µL

BAIAP2 (Brain-specific Angiogenesis Inhibitor 1-associated Protein 2, BAI1-associated Protein 2, BAI-associated Protein 2, Protein BAP2, Insulin Receptor Substrate Protein of 53kD, Insulin Receptor Substrate p53, IRSp53, Insulin Receptor Substrate p53/p58, IRSp53/58, IRS-58, Fas Ligand-associated Factor 3, FLAF3) (FITC)

Sign In for Pricing
View Details
Polyclonal Antibody to Laminin Receptor 1 (LAMR1)
TRV-0059033-01 20 µL

Polyclonal Antibody to Laminin Receptor 1 (LAMR1)

Sign In for Pricing
View Details
Polyclonal Antibody to Laminin Receptor 1 (LAMR1)
TRV-0059033-02 100 µL

Polyclonal Antibody to Laminin Receptor 1 (LAMR1)

Sign In for Pricing
View Details
Polyclonal Antibody to Laminin Receptor 1 (LAMR1)
TRV-0059033-03 200 µL

Polyclonal Antibody to Laminin Receptor 1 (LAMR1)

Sign In for Pricing
View Details