Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD69 Rabbit Polyclonal Antibody (Biotin)

CD69 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AIM, EA1, MLR-3, CLEC2C, GP32/28, BL-AC/P26

UniProt

Q07108

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKK

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001772

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALK (pY1507) Antibody
abx333043 100 µL

ALK (pY1507) Antibody

Sign In for Pricing
View Details
Genesig Real-Time PCR Detection Kit for Classical Swine Fever Virus CSFV, Standard discontinued
530111 1 Kit

Genesig Real-Time PCR Detection Kit for Classical Swine Fever Virus CSFV, Standard discontinued

Sign In for Pricing
View Details
Bromophenol Blue sodium salt
11223423 25 g

Bromophenol Blue sodium salt

Sign In for Pricing
View Details
Mouse Monoclonal CD42b/GPIb alpha Antibody (AK2) [DyLight 350]
NB100-63790UV 0.1 mL

Mouse Monoclonal CD42b/GPIb alpha Antibody (AK2) [DyLight 350]

Sign In for Pricing
View Details
MON1B (NM_014940) Human Recombinant Protein
PH38712M5 20 µg

MON1B (NM_014940) Human Recombinant Protein

Sign In for Pricing
View Details
CTSE (Cathepsin E, CATE) (HRP)
125468-HRP 100 µL

CTSE (Cathepsin E, CATE) (HRP)

Sign In for Pricing
View Details