Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD69 Rabbit Polyclonal Antibody (HRP)

CD69 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AIM, EA1, MLR-3, CLEC2C, GP32/28, BL-AC/P26

UniProt

Q07108

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKK

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001772

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FN1 protein
orb391756-01 10 µg

Human FN1 protein

Sign In for Pricing
View Details
Human FN1 protein
orb391756-02 50 µg

Human FN1 protein

Sign In for Pricing
View Details
Human FN1 protein
orb391756-03 500 µg

Human FN1 protein

Sign In for Pricing
View Details
ST6GAL1 (Beta-galactoside alpha-2,6-sialyltransferase 1, Alpha 2,6-ST 1, B Cell Antigen CD75, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1, ST6Gal I, ST6GalI, Sialyltransferase 1, SIAT1) (MaxLight 650)
133901-ML650 100 µL

ST6GAL1 (Beta-galactoside alpha-2,6-sialyltransferase 1, Alpha 2,6-ST 1, B Cell Antigen CD75, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1, ST6Gal I, ST6GalI, Sialyltransferase 1, SIAT1) (MaxLight 650)

Sign In for Pricing
View Details
Mmu-miR-744-3p miRNA Agomir
orb1918503-01 5 nmol

Mmu-miR-744-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-744-3p miRNA Agomir
orb1918503-02 10 nmol

Mmu-miR-744-3p miRNA Agomir

Sign In for Pricing
View Details