Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sms Rabbit Polyclonal Antibody (FITC)

Sms Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Gy, Sp, gyro, SPMSY, SpmST, AI427066

UniProt

P97355

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033240

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken L-Amino-Acid Oxidase (LAO) ELISA Kit-Sandwich
EK8F53-01 48 Test

Chicken L-Amino-Acid Oxidase (LAO) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Chicken L-Amino-Acid Oxidase (LAO) ELISA Kit-Sandwich
EK8F53-02 96 Tests

Chicken L-Amino-Acid Oxidase (LAO) ELISA Kit-Sandwich

Sign In for Pricing
View Details
C1orf59 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV809460 1.0 µg DNA

C1orf59 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Lentiviral mouse Slc25a18 shRNA (UAS) - Lentiviral mouseSlc25a18 shRNA (UAS, GFP) (25)
GTR15234608 1 Vial

Lentiviral mouse Slc25a18 shRNA (UAS) - Lentiviral mouseSlc25a18 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Aadacl1 Rabbit Polyclonal Antibody (FITC)
orb2112948 100 µL

Aadacl1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CRK Rabbit Polyclonal Antibody (Cy5)
orb902562 100 µL

CRK Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details