Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sms Rabbit Polyclonal Antibody (HRP)

Sms Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gy, Sp, gyro, SPMSY, SpmST, AI427066

UniProt

P97355

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033240

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rno-miR-1193-5p miRNA Agomir
orb1916438-01 5 nmol

Rno-miR-1193-5p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-1193-5p miRNA Agomir
orb1916438-02 10 nmol

Rno-miR-1193-5p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-1193-5p miRNA Agomir
orb1916438-03 20 nmol

Rno-miR-1193-5p miRNA Agomir

Sign In for Pricing
View Details
Myosin-8 (MYH8) Mouse ELISA Kit
F1994 96 Tests

Myosin-8 (MYH8) Mouse ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) SHE9 Polyclonal Antibody
MBS7197074 Inquire

Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) SHE9 Polyclonal Antibody

Sign In for Pricing
View Details
HIST1H1C Antibody
A49890-50UL 50 μL

HIST1H1C Antibody

Sign In for Pricing
View Details