Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1A Rabbit Polyclonal Antibody (Biotin)

CD1A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

R4, T6, CD1, FCB6, HTA1

UniProt

P06126

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KPEAWLSHGPSPGPGHLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQRGDI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001754

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

WISP3 Antibody
42859 100 µL

WISP3 Antibody

Sign In for Pricing
View Details
PCMT1 Recombinant Protein
OPCD06014-200UG 200 µg

PCMT1 Recombinant Protein

Sign In for Pricing
View Details
2610018G03Rik Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
10458064 1.0 µg DNA

2610018G03Rik Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
C19orf10 (UPF0556 Protein C19orf10, Interleukin-25, IL-25, Stromal Cell-derived Growth Factor SF20, IL25, IL27, IL-27, IL27w, R33729_1, SF20, UPF0556 Orotein C19orf10) (MaxLight 650)
MBS6221162-01 0.1 mL

C19orf10 (UPF0556 Protein C19orf10, Interleukin-25, IL-25, Stromal Cell-derived Growth Factor SF20, IL25, IL27, IL-27, IL27w, R33729_1, SF20, UPF0556 Orotein C19orf10) (MaxLight 650)

Sign In for Pricing
View Details
C19orf10 (UPF0556 Protein C19orf10, Interleukin-25, IL-25, Stromal Cell-derived Growth Factor SF20, IL25, IL27, IL-27, IL27w, R33729_1, SF20, UPF0556 Orotein C19orf10) (MaxLight 650)
MBS6221162-02 5x 0.1 mL

C19orf10 (UPF0556 Protein C19orf10, Interleukin-25, IL-25, Stromal Cell-derived Growth Factor SF20, IL25, IL27, IL-27, IL27w, R33729_1, SF20, UPF0556 Orotein C19orf10) (MaxLight 650)

Sign In for Pricing
View Details
Monkey TTR (Transthyretin) QuickTest ELISA Kit
MBS7619547-01 48 Well

Monkey TTR (Transthyretin) QuickTest ELISA Kit

Sign In for Pricing
View Details