Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1A Rabbit Polyclonal Antibody (FITC)

CD1A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

R4, T6, CD1, FCB6, HTA1

UniProt

P06126

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KPEAWLSHGPSPGPGHLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQRGDI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001754

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1826 sgRNA CRISPR Lentivector (Human) (Target 3)
K1144004 1.0 µg DNA

KIAA1826 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
MOX-2 (A-8) Alexa Fluor® 594
sc-376748 AF594 200 µg/mL

MOX-2 (A-8) Alexa Fluor® 594

Sign In for Pricing
View Details
P15RS (RPRD1A) Rabbit Polyclonal Antibody
TA381086 100 µL

P15RS (RPRD1A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NAPRT1 AAV Vector (Human) (CMV)
31454101 1 µg

NAPRT1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Pesticide Standards Mixture, 3 components, 100mg/l each with Simazine and Terbuthylazine in Acetone
F263221 1 mL

Pesticide Standards Mixture, 3 components, 100mg/l each with Simazine and Terbuthylazine in Acetone

Sign In for Pricing
View Details
EGR4 discontinued
388624 200 µL

EGR4 discontinued

Sign In for Pricing
View Details