Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1A Rabbit Polyclonal Antibody (HRP)

CD1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

R4, T6, CD1, FCB6, HTA1

UniProt

P06126

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KPEAWLSHGPSPGPGHLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQRGDI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001754

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CE164, NT (CEP164, KIAA1052, Centrosomal protein of 164kD) (MaxLight 550) discontinued
033741-ML550 100 µL

CE164, NT (CEP164, KIAA1052, Centrosomal protein of 164kD) (MaxLight 550) discontinued

Sign In for Pricing
View Details
EphA6, CT (Ephrin Type-A Receptor 6, EPH Homology Kinase 2, EHK-2, Ehk-2, Ehk2) (MaxLight 750) discontinued
E3363-05C-ML750 100 µL

EphA6, CT (Ephrin Type-A Receptor 6, EPH Homology Kinase 2, EHK-2, Ehk-2, Ehk2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
AUP1 Protein Vector (Human) (pPB-His-GST)
PV325747 500 ng

AUP1 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
FBXO15, NT (FBXO15, FBX15, F-box only protein 15) (MaxLight 405)
MBS6298323-01 0.1 mL

FBXO15, NT (FBXO15, FBX15, F-box only protein 15) (MaxLight 405)

Sign In for Pricing
View Details
FBXO15, NT (FBXO15, FBX15, F-box only protein 15) (MaxLight 405)
MBS6298323-02 5x 0.1 mL

FBXO15, NT (FBXO15, FBX15, F-box only protein 15) (MaxLight 405)

Sign In for Pricing
View Details
LINC00085 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV799468 1.0 µg DNA

LINC00085 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details