Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fgfr1 Rabbit Polyclonal Antibody (Biotin)

Fgfr1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ea, Fr, Hs, FLG, Fr1, MFR, Eask, FGFR, Flt-, Hspy, Fgfr-, Flt-2, c-fgr, FGFR-I, Fgfr-1, AW208770, bFGF-R-1

UniProt

P16092

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Fgfr1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKM

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034336

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cullin 1 (CUL-1)
C7949-08 100 µg

Cullin 1 (CUL-1)

Sign In for Pricing
View Details
Recombinant Mouse IL-10 Protein (His Tag)
PDMM100238-01 20 µg

Recombinant Mouse IL-10 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-10 Protein (His Tag)
PDMM100238-02 100 µg

Recombinant Mouse IL-10 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-10 Protein (His Tag)
PDMM100238-03 500 µg

Recombinant Mouse IL-10 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-10 Protein (His Tag)
PDMM100238-04 1 mg

Recombinant Mouse IL-10 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD295/LEPR Protein, C-Fc
EHE57002 100 μg

Recombinant Human CD295/LEPR Protein, C-Fc

Sign In for Pricing
View Details