Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf30 Rabbit Polyclonal Antibody (HRP)

C9orf30 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L8, C9orf30

UniProt

Q96H12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSTHVLGKEKIASMLPEQLYFLQSPPEEEPEYHPDASAQESFAVSNRELC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_542386

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Muscle, skeletal receptor tyrosine protein kinase (Musk), partial
CSB-EP733845RA-01 20 µg

Recombinant Rat Muscle, skeletal receptor tyrosine protein kinase (Musk), partial

Sign In for Pricing
View Details
Recombinant Rat Muscle, skeletal receptor tyrosine protein kinase (Musk), partial
CSB-EP733845RA-02 100 µg

Recombinant Rat Muscle, skeletal receptor tyrosine protein kinase (Musk), partial

Sign In for Pricing
View Details
Recombinant Rat Muscle, skeletal receptor tyrosine protein kinase (Musk), partial
CSB-EP733845RA-03 1 mg

Recombinant Rat Muscle, skeletal receptor tyrosine protein kinase (Musk), partial

Sign In for Pricing
View Details
Recombinant Human PHKA2 Protein - (Dry Ice)
H00005256-P01-25ug 25 µg

Recombinant Human PHKA2 Protein - (Dry Ice)

Sign In for Pricing
View Details
SPINT2 Protein Lysate (Mouse) with C-HA Tag
45345034 100 µg

SPINT2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Chlamydia pneumoniae COMC Antigen
BA1371VS 1mg

Chlamydia pneumoniae COMC Antigen

Sign In for Pricing
View Details