Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AADACL3 Rabbit Polyclonal Antibody (FITC)

AADACL3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RP11-474O21.3

UniProt

Q5VUY0

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YRKWLGPENIPERFKERGYQLKPHEPMNEAAYLEVSVVLDVMCSPLIAED

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001096640

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (4-Phenyl-1H-imidazol-2-yl) ethan-1-amine
DWB54794-01 100 mg

1- (4-Phenyl-1H-imidazol-2-yl) ethan-1-amine

Sign In for Pricing
View Details
1- (4-Phenyl-1H-imidazol-2-yl) ethan-1-amine
DWB54794-02 1 g

1- (4-Phenyl-1H-imidazol-2-yl) ethan-1-amine

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces Pombe spf31 Protein (aa 1-209)
VAng-Yyj6242-50gEcoli 50 µg (E. coli)

Recombinant Schizosaccharomyces Pombe spf31 Protein (aa 1-209)

Sign In for Pricing
View Details
ERK 5 (C-11) Alexa Fluor® 594
sc-393405 AF594 200 µg/mL

ERK 5 (C-11) Alexa Fluor® 594

Sign In for Pricing
View Details
Semaphorin-3C (SEMA3C) Human ELISA Kit
G9510 96 Tests

Semaphorin-3C (SEMA3C) Human ELISA Kit

Sign In for Pricing
View Details
PIP5K2A, CT (Phosphatidylinositol-5-phosphate 4-kinase Type-2 alpha, 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha, Diphosphoinositide Kinase 2-alpha, PIP5KIII, Phosphatidylinositol-5-phosphate 4-kinase Type II alpha, PI (5) P 4-kinase Type II alpha, PIP4KII-alpha, PtdIns (4) P-5-kinase B Isoform, PtdIns (4) P-5-kinase C Isoform, PtdIns (5) P-4-kinase Isoform 2-alpha, PIP4K2A, PIP5K2) (AP) discontinued
P4071-78A2-AP 200 µL

PIP5K2A, CT (Phosphatidylinositol-5-phosphate 4-kinase Type-2 alpha, 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha, Diphosphoinositide Kinase 2-alpha, PIP5KIII, Phosphatidylinositol-5-phosphate 4-kinase Type II alpha, PI (5) P 4-kinase Type II alpha, PIP4KII-alpha, PtdIns (4) P-5-kinase B Isoform, PtdIns (4) P-5-kinase C Isoform, PtdIns (5) P-4-kinase Isoform 2-alpha, PIP4K2A, PIP5K2) (AP) discontinued

Sign In for Pricing
View Details