Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDIAS Rabbit Polyclonal Antibody (HRP)

DDIAS Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Noxin, C11orf82

UniProt

B4DMA1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human DDIAS

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AFKKPVFYSDLDGNYEKIRIFPENDKQQASPSCPKNIKTPSQKIRSPIVS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

XP_011543139.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDPR Human Gene Knockout Kit (CRISPR)
KN418100 1 Kit

PDPR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Foxo3 Mouse Gene Knockout Kit (CRISPR)
KN306098BN 1 Kit

Foxo3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL
BNC040669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Exosome Component 9 (EXOSC9) (NM_001034194) Human Recombinant Protein
TP323537L 1 mg

Exosome Component 9 (EXOSC9) (NM_001034194) Human Recombinant Protein

Sign In for Pricing
View Details
Adtrp Mouse Gene Knockout Kit (CRISPR)
KN500942 1 Kit

Adtrp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lamin A + Lamin C Recombinant Rabbit monoclonal Antibody
HA750991 100 µL

Lamin A + Lamin C Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details