Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CCAAT/enhancer-binding protein delta (CEBPD)

Product Specifications

Product Name Alternative

Nuclear factor NF-IL6-beta (NF-IL6-beta) (C/EBP delta)

Abbreviation

Recombinant Human CEBPD protein

Gene Name

CEBPD

UniProt

P49716

Expression Region

2-269aa

Organism

Homo sapiens (Human)

Target Sequence

SAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. Important transcription factor regulating the expression of genes involved in immune and inflammatory responses. Transcriptional activator that enhances IL6 transcription alone and as heterodimer with CEBPB.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.8 kDa

References & Citations

"Signal transducer and activator of transcription 3 activates CCAAT enhancer-binding protein delta gene transcription in G0 growth-arrested mouse mammary epithelial cells and in involuting mouse mammary gland." Hutt J.A., O'Rourke J.P., DeWille J. J. Biol. Chem. 275:29123-29131 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal IgD Antibody (IGHD/6818R) [DyLight 594]
NBP3-20992DL594 0.1 mL

Rabbit Monoclonal IgD Antibody (IGHD/6818R) [DyLight 594]

Sign In for Pricing
View Details
Thermo ES Series Fridge 158L Capacity UK Plug Boxed - EACH
FRE1118 1 Each

Thermo ES Series Fridge 158L Capacity UK Plug Boxed - EACH

Sign In for Pricing
View Details
Recombinant Human EXOC8 Protein
E30P9576 20 µg

Recombinant Human EXOC8 Protein

Sign In for Pricing
View Details
EGR3 Human shRNA Plasmid Kit (Locus ID 1960)
TL313275 1 Kit

EGR3 Human shRNA Plasmid Kit (Locus ID 1960)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Ligase-interacting factor 1 (LIF1)
MBS1104931-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Ligase-interacting factor 1 (LIF1)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Ligase-interacting factor 1 (LIF1)
MBS1104931-02 0.02 mg (Yeast)

Recombinant Saccharomyces cerevisiae Ligase-interacting factor 1 (LIF1)

Sign In for Pricing
View Details