Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HEATR9 Rabbit Polyclonal Antibody (HRP)

HEATR9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C17orf66

UniProt

A2RTY3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C17orf66

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AILGCLNKHVIRALIKQLKEKNEGQRMETLTGLRMALNSWAAVSKDKRTQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSCAR, CT (OSCAR, Osteoclast-associated immunoglobulin-like receptor, Polymeric immunoglobulin receptor 3) (MaxLight 405)
MBS6329729-01 0.1 mL

OSCAR, CT (OSCAR, Osteoclast-associated immunoglobulin-like receptor, Polymeric immunoglobulin receptor 3) (MaxLight 405)

Sign In for Pricing
View Details
OSCAR, CT (OSCAR, Osteoclast-associated immunoglobulin-like receptor, Polymeric immunoglobulin receptor 3) (MaxLight 405)
MBS6329729-02 5x 0.1 mL

OSCAR, CT (OSCAR, Osteoclast-associated immunoglobulin-like receptor, Polymeric immunoglobulin receptor 3) (MaxLight 405)

Sign In for Pricing
View Details
Tide Quencher™ 4WS acid [TQ4WS acid]
2060-AAT 5 mg

Tide Quencher™ 4WS acid [TQ4WS acid]

Sign In for Pricing
View Details
Anti-Carboxypeptidase E/CPE Antibody, Rabbit Polyclonal
MBS8100599-01 0.1 mL

Anti-Carboxypeptidase E/CPE Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Carboxypeptidase E/CPE Antibody, Rabbit Polyclonal
MBS8100599-02 5x 0.1 mL

Anti-Carboxypeptidase E/CPE Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
GPR84 Rabbit Polyclonal Antibody (BF680)
orb1583863 100 µL

GPR84 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details