Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angpt2 Rabbit Polyclonal Antibody (FITC)

Angpt2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

An, Ang, Ang2, Agpt2, Ang-2

UniProt

O35608

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Angpt2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEG

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_031452

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ANP32D Antibody
CPA2580-01 30 µL

Anti-ANP32D Antibody

Sign In for Pricing
View Details
Anti-ANP32D Antibody
CPA2580-02 50 μL

Anti-ANP32D Antibody

Sign In for Pricing
View Details
Anti-ANP32D Antibody
CPA2580-03 100 µL

Anti-ANP32D Antibody

Sign In for Pricing
View Details
Anti-ANP32D Antibody
CPA2580-04 200 µL

Anti-ANP32D Antibody

Sign In for Pricing
View Details
Dsg2 (Desmoglein 2, 1829, DSG2, 125671, Q14126, CDHF5, HDGC, MGC117034, MGC117036, MGC117037, , Mouse monoclonal [3G132] to Desmoglein 2, 1829, DSG2, 125671, Q14126, CDHF5, HDGC, MGC117034, MGC117036, MGC117037, , Desmoglein-2) discontinued
222246-01 50 µL

Dsg2 (Desmoglein 2, 1829, DSG2, 125671, Q14126, CDHF5, HDGC, MGC117034, MGC117036, MGC117037, , Mouse monoclonal [3G132] to Desmoglein 2, 1829, DSG2, 125671, Q14126, CDHF5, HDGC, MGC117034, MGC117036, MGC117037, , Desmoglein-2) discontinued

Sign In for Pricing
View Details
Dsg2 (Desmoglein 2, 1829, DSG2, 125671, Q14126, CDHF5, HDGC, MGC117034, MGC117036, MGC117037, , Mouse monoclonal [3G132] to Desmoglein 2, 1829, DSG2, 125671, Q14126, CDHF5, HDGC, MGC117034, MGC117036, MGC117037, , Desmoglein-2) discontinued
222246-02 100 µL

Dsg2 (Desmoglein 2, 1829, DSG2, 125671, Q14126, CDHF5, HDGC, MGC117034, MGC117036, MGC117037, , Mouse monoclonal [3G132] to Desmoglein 2, 1829, DSG2, 125671, Q14126, CDHF5, HDGC, MGC117034, MGC117036, MGC117037, , Desmoglein-2) discontinued

Sign In for Pricing
View Details