Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prnp Rabbit Polyclonal Antibody (Biotin)

Prnp Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P, S, PrP, PrPC, Sinc, CD230, PrPSc, Prn-i, Prn-p, PrP, AA960666, AI325101, prP27-30, prP33-35C

UniProt

P04925

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Prnp

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Human, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_035300

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100504240 3'UTR GFP Stable Cell Line
TU162009 1.0 mL

LOC100504240 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human INSR sgRNA gene knockout kit - Lentiviral human INSR sgRNA gene knockout kit (plasmid)
GTR15363956 1 Vial

Lentiviral human INSR sgRNA gene knockout kit - Lentiviral human INSR sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
NRARP (NM_001004354) Human Over-expression Lysate
LS441478-20ug 20 µg

NRARP (NM_001004354) Human Over-expression Lysate

Sign In for Pricing
View Details
Porcine Chondroitin Sulfate Epitope 3B3 ELISA Kit
MBS742727-01 48 Well

Porcine Chondroitin Sulfate Epitope 3B3 ELISA Kit

Sign In for Pricing
View Details
Porcine Chondroitin Sulfate Epitope 3B3 ELISA Kit
MBS742727-02 96 Well

Porcine Chondroitin Sulfate Epitope 3B3 ELISA Kit

Sign In for Pricing
View Details
Porcine Chondroitin Sulfate Epitope 3B3 ELISA Kit
MBS742727-03 5x 96 Well

Porcine Chondroitin Sulfate Epitope 3B3 ELISA Kit

Sign In for Pricing
View Details