Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRPE Rabbit Polyclonal Antibody (HRP)

SNRPE Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SME, Sm-E, HYPT11, snRNP-E

UniProt

P62304

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIML

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_003085

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human NOL1/NOP2/Sun domain family, member 5 polyclonal Antibody
MBS714965-01 0.1 mL

Rabbit anti-human NOL1/NOP2/Sun domain family, member 5 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human NOL1/NOP2/Sun domain family, member 5 polyclonal Antibody
MBS714965-02 5x 0.1 mL

Rabbit anti-human NOL1/NOP2/Sun domain family, member 5 polyclonal Antibody

Sign In for Pricing
View Details
MLKL Rabbit Monoclonal Antibody [Clone ID: 24GB4615]
TA424988 100 µL

MLKL Rabbit Monoclonal Antibody [Clone ID: 24GB4615]

Sign In for Pricing
View Details
Rabbit Polyclonal SLC44A3 Antibody
NBP2-98569-100ul 100 µL

Rabbit Polyclonal SLC44A3 Antibody

Sign In for Pricing
View Details
ELAVL1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61688R-BF555-TR 20 µL

ELAVL1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
ICK (Intestinal Cell Kinase, LCK2, MRK, Serine/threonine-protein kinase ICK, Laryngeal cancer kinase 2, MAK-related kinase)
363545 200 µL

ICK (Intestinal Cell Kinase, LCK2, MRK, Serine/threonine-protein kinase ICK, Laryngeal cancer kinase 2, MAK-related kinase)

Sign In for Pricing
View Details