Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRPE Rabbit Polyclonal Antibody (HRP)

SNRPE Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SME, Sm-E, HYPT11, snRNP-E

UniProt

P62304

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIML

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_003085

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Hepatitis B HBsAg preS2 Protein, Untagged, E.coli-1mg
QP12129-1mg 1mg

Recombinant Hepatitis B HBsAg preS2 Protein, Untagged, E.coli-1mg

Sign In for Pricing
View Details
THT-42-728-10 AB Labels
139876 Roll of 10000 Label(s)

THT-42-728-10 AB Labels

Sign In for Pricing
View Details
Anti-Heme oxygenase 2/HMOX2 Antibody Picoband® Fluoro488 Conjugated
PB9213-Fluoro488 100 µg/Vial

Anti-Heme oxygenase 2/HMOX2 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
LUC7L2 polyclonal antibody
orb647792-01 50 μL

LUC7L2 polyclonal antibody

Sign In for Pricing
View Details
LUC7L2 polyclonal antibody
orb647792-02 100 µL

LUC7L2 polyclonal antibody

Sign In for Pricing
View Details
LUC7L2 polyclonal antibody
orb647792-03 200 µL

LUC7L2 polyclonal antibody

Sign In for Pricing
View Details