Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRPE Rabbit Polyclonal Antibody (HRP)

SNRPE Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SME, Sm-E, HYPT11, snRNP-E

UniProt

P62304

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003085

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIC W021- Tri 050-PE-SHEET/7 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)
829425 7 Sheet (7 Panel (s) x 1 Sheet)

PIC W021- Tri 050-PE-SHEET/7 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)

Sign In for Pricing
View Details
β -Amyloid (35-42) 5mg
A22976-5 5 mg

β -Amyloid (35-42) 5mg

Sign In for Pricing
View Details
Diphenyl Acetic Acid for Synthesis
078255-01 100 g

Diphenyl Acetic Acid for Synthesis

Sign In for Pricing
View Details
Diphenyl Acetic Acid for Synthesis
078255-02 500 g

Diphenyl Acetic Acid for Synthesis

Sign In for Pricing
View Details
Anti-NUP35 Antibody Picoband®
A08614-2 100 µg/Vial

Anti-NUP35 Antibody Picoband®

Sign In for Pricing
View Details
SUGT1 protein (His tag)
80R-1657 0.1 mg

SUGT1 protein (His tag)

Sign In for Pricing
View Details