Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALP Rabbit Polyclonal Antibody (HRP)

GALP Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9UBC7

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence VLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKP

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

IHC

NCBI Accession Number

NP_149097

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTCH1 Rabbit Polyclonal Antibody
AP06278PU-N 100 µg

PTCH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Apolipoprotein A II (APOA2) Human Gene Knockout Kit (CRISPR)
KN402723 1 Kit

Apolipoprotein A II (APOA2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (8G7G3/1 + NX2.1/690), CF568 conjugate, 0.1mg/mL
BNC680907-500 1x 500 µL

TTF-1 / NKX2.1 (8G7G3/1 + NX2.1/690), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD23 (FCER2) Mouse Monoclonal Antibody [Clone ID: B-G6]
AM31232PU-N 2 mL (200 Tests)

CD23 (FCER2) Mouse Monoclonal Antibody [Clone ID: B-G6]

Sign In for Pricing
View Details
NAB1 (NM_005966) Human Over-expression Lysate
LC401805 20 µg

NAB1 (NM_005966) Human Over-expression Lysate

Sign In for Pricing
View Details
Apoc2 Mouse Gene Knockout Kit (CRISPR)
KN501417 1 Kit

Apoc2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details