Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPO Rabbit Polyclonal Antibody (HRP)

CPO Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC138281, MGC138283

UniProt

Q8IVL8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EWIAPAFCQWFVKEILQNHKDNSSIRKLLRNLDFYVLPVLNIDGYIYTWT

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_775100

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal 4-1BB/TNFRSF9/CD137 Antibody (2356B) [Janelia Fluor 669]
FAB8381JF669 0.1 mL

Rabbit Monoclonal 4-1BB/TNFRSF9/CD137 Antibody (2356B) [Janelia Fluor 669]

Sign In for Pricing
View Details
Endophilin B2 CRISPR Activation Plasmid (h)
sc-405806-ACT 20 µg

Endophilin B2 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Lentiviral mouse Kmt2a shRNA (UAS) - Lentiviral mouse Kmt2a shRNA (UAS, iRFP) plasmid
GTR15202840 1 Vial

Lentiviral mouse Kmt2a shRNA (UAS) - Lentiviral mouse Kmt2a shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Chicken natural killer cell (NK) ELISA Kit
MBS2604348-01 48 Well

Chicken natural killer cell (NK) ELISA Kit

Sign In for Pricing
View Details
Chicken natural killer cell (NK) ELISA Kit
MBS2604348-02 96 Well

Chicken natural killer cell (NK) ELISA Kit

Sign In for Pricing
View Details
Chicken natural killer cell (NK) ELISA Kit
MBS2604348-03 5x 96 Well

Chicken natural killer cell (NK) ELISA Kit

Sign In for Pricing
View Details