Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY2 Rabbit Polyclonal Antibody (FITC)

P2RY2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P2U, HP2U, P2U1, P2UR, P2Y2, P2RU1, P2Y2R

UniProt

P41231

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSRRTESTPAGSE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_788085

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)
MBS2118978-01 0.1 mL

PE-Linked Polyclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)
MBS2118978-02 0.2 mL

PE-Linked Polyclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)
MBS2118978-03 0.5 mL

PE-Linked Polyclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)
MBS2118978-04 1 mL

PE-Linked Polyclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)
MBS2118978-05 5 mL

PE-Linked Polyclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)
MBS2118978-06 5x 5 mL

PE-Linked Polyclonal Antibody to Receptor Interacting Serine Threonine Kinase 3 (RIPK3)

Sign In for Pricing
View Details