Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY2 Rabbit Polyclonal Antibody (HRP)

P2RY2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P2U, HP2U, P2U1, P2UR, P2Y2, P2RU1, P2Y2R

UniProt

P41231

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSRRTESTPAGSE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_788085

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-1261 mimic
HY-R00169-01 5 nmol

Hsa-miR-1261 mimic

Sign In for Pricing
View Details
Hsa-miR-1261 mimic
HY-R00169-02 20 nmol

Hsa-miR-1261 mimic

Sign In for Pricing
View Details
Anti-mitF/aspF1 Antibody (SAA0654)
RXX08702 100 μg

Anti-mitF/aspF1 Antibody (SAA0654)

Sign In for Pricing
View Details
Human IL36B (Interleukin-36 beta) QuickTest ELISA Kit
MBS7618865-01 48 Well

Human IL36B (Interleukin-36 beta) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human IL36B (Interleukin-36 beta) QuickTest ELISA Kit
MBS7618865-02 96 Well

Human IL36B (Interleukin-36 beta) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human IL36B (Interleukin-36 beta) QuickTest ELISA Kit
MBS7618865-03 5x 96 Well

Human IL36B (Interleukin-36 beta) QuickTest ELISA Kit

Sign In for Pricing
View Details