Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIN1 Rabbit Polyclonal Antibody (FITC)

PIN1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DOD, UBL5

UniProt

Q13526

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006212

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human NIM1K sgRNA gene knockout kit - Lentiviral human NIM1K sgRNA gene knockout kit (100)
GTR15367285 1 Vial

Lentiviral human NIM1K sgRNA gene knockout kit - Lentiviral human NIM1K sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Lentiviral human YIPF6 sgRNA gene knockout kit - Lentiviral human YIPF6 sgRNA gene knockout kit (plasmid)
GTR15371504 1 Vial

Lentiviral human YIPF6 sgRNA gene knockout kit - Lentiviral human YIPF6 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Recombinant Brucella Suis tam Protein (aa 1-255)
VAng-Lsx5619-50gEcoli 50 µg (E. coli)

Recombinant Brucella Suis tam Protein (aa 1-255)

Sign In for Pricing
View Details
Recombinant Bovine Immunoglobulin superfamily containing leucine-rich repeat protein (ISLR)
MBS1057537-01 0.02 mg (E-Coli)

Recombinant Bovine Immunoglobulin superfamily containing leucine-rich repeat protein (ISLR)

Sign In for Pricing
View Details
Recombinant Bovine Immunoglobulin superfamily containing leucine-rich repeat protein (ISLR)
MBS1057537-02 0.02 mg (Yeast)

Recombinant Bovine Immunoglobulin superfamily containing leucine-rich repeat protein (ISLR)

Sign In for Pricing
View Details
Recombinant Bovine Immunoglobulin superfamily containing leucine-rich repeat protein (ISLR)
MBS1057537-03 0.1 mg (E-Coli)

Recombinant Bovine Immunoglobulin superfamily containing leucine-rich repeat protein (ISLR)

Sign In for Pricing
View Details