Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial (Active)

Product Specifications

Product Name Alternative

Gastric inhibitory polypeptide receptor; GIP-R; Glucose-dependent insulinotropic polypeptide receptor; Gipr

Abbreviation

Recombinant Mouse Gipr protein, partial (Active)

Gene Name

Gipr

UniProt

Q0P543

Expression Region

19-134aa

Organism

Mus musculus (Mouse)

Target Sequence

ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Obesity

Relevance

May play an important role in blood sugar regulation.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Gipr at 2 μg/mL can bind Anti-Mouse Gipr Recombinant Antibody (CSB-RA009438MA1MO), the EC50 is 8.622-11.36 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.7 kDa

References & Citations

"Lineage-specific biology revealed by a finished genome assembly of the mouse." Am J Physiol Endocrinol Metab 294:E61-8 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse GITR Ligand Protein, hFc Tag
TP724338 100 µg

Mouse GITR Ligand Protein, hFc Tag

Sign In for Pricing
View Details
CORO1B (NM_020441) Human Recombinant Protein
PH40559M5 20 µg

CORO1B (NM_020441) Human Recombinant Protein

Sign In for Pricing
View Details
NARS (Asparagine-tRNA Ligase, Cytoplasmic, Asparaginyl-tRNA Synthetase, AsnRS) (MaxLight 405) discontinued
130152-ML405 100 µL

NARS (Asparagine-tRNA Ligase, Cytoplasmic, Asparaginyl-tRNA Synthetase, AsnRS) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant human FOLR1 protein
ATGP3518-100 100 µg

Recombinant human FOLR1 protein

Sign In for Pricing
View Details
Recombinant Influenza A virus Non-structural protein 1 (NS)
MBS1174618-01 0.02 mg (E-Coli)

Recombinant Influenza A virus Non-structural protein 1 (NS)

Sign In for Pricing
View Details
Recombinant Influenza A virus Non-structural protein 1 (NS)
MBS1174618-02 0.1 mg (E-Coli)

Recombinant Influenza A virus Non-structural protein 1 (NS)

Sign In for Pricing
View Details