Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLRK1 Rabbit Polyclonal Antibody (HRP)

KLRK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KLR, CD314, NKG2D, NKG2-D, D12S2489E

UniProt

P26718

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWED

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_031386

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACOX2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0030908 1.0 µg DNA

ACOX2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
ATP6AP1 (V-type Proton ATPase Subunit S1, V-ATPase Subunit S1, Protein XAP-3, V-ATPase Ac45 Subunit, V-ATPase S1 Accessory Protein, Vacuolar Proton Pump Subunit S1, ATP6IP1, ATP6S1, VATPS1, XAP3) (MaxLight 650)
MBS6370724-01 0.1 mL

ATP6AP1 (V-type Proton ATPase Subunit S1, V-ATPase Subunit S1, Protein XAP-3, V-ATPase Ac45 Subunit, V-ATPase S1 Accessory Protein, Vacuolar Proton Pump Subunit S1, ATP6IP1, ATP6S1, VATPS1, XAP3) (MaxLight 650)

Sign In for Pricing
View Details
ATP6AP1 (V-type Proton ATPase Subunit S1, V-ATPase Subunit S1, Protein XAP-3, V-ATPase Ac45 Subunit, V-ATPase S1 Accessory Protein, Vacuolar Proton Pump Subunit S1, ATP6IP1, ATP6S1, VATPS1, XAP3) (MaxLight 650)
MBS6370724-02 5x 0.1 mL

ATP6AP1 (V-type Proton ATPase Subunit S1, V-ATPase Subunit S1, Protein XAP-3, V-ATPase Ac45 Subunit, V-ATPase S1 Accessory Protein, Vacuolar Proton Pump Subunit S1, ATP6IP1, ATP6S1, VATPS1, XAP3) (MaxLight 650)

Sign In for Pricing
View Details
Human NYX qPCR Primer Pair
QH49265S 200 Tests

Human NYX qPCR Primer Pair

Sign In for Pricing
View Details
Dimethyl-morpholin-2-ylmethylamine
274024-01 100 mg

Dimethyl-morpholin-2-ylmethylamine

Sign In for Pricing
View Details
Dimethyl-morpholin-2-ylmethylamine
274024-02 250 mg

Dimethyl-morpholin-2-ylmethylamine

Sign In for Pricing
View Details