Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INVS Rabbit Polyclonal Antibody (FITC)

INVS Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

INV, NPH2, NPHP2

UniProt

Q9Y283

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence CVLADRLDCADALLKAGADVNKTDHSQRTALHLAAQKGNYRFMKLLLTRR

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CVLADRLDCADALLKAGADVNKTDHSQRTALHLAAQKGNYRFMKLLLTRR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

118 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat, Zebrafish

NCBI Accession Number

NP_055240

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Legionella pneumophila Antibody
GWB-73B40C 1 mL

Legionella pneumophila Antibody

Sign In for Pricing
View Details
Mouse SOSS complex subunit B1, Obfc2b ELISA KIT
ELI-30056m 96 Tests

Mouse SOSS complex subunit B1, Obfc2b ELISA KIT

Sign In for Pricing
View Details
6-(O-Phosphorylcholine)hydroxyhexanoic Acid
TRC-P360800-50MG 50 mg

6-(O-Phosphorylcholine)hydroxyhexanoic Acid

Sign In for Pricing
View Details
GABPA (GA Binding Protein Transcription Factor, alpha Subunit 60kD, E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A) (MaxLight 550)
MBS6217029-01 0.1 mL

GABPA (GA Binding Protein Transcription Factor, alpha Subunit 60kD, E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A) (MaxLight 550)

Sign In for Pricing
View Details
GABPA (GA Binding Protein Transcription Factor, alpha Subunit 60kD, E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A) (MaxLight 550)
MBS6217029-02 5x 0.1 mL

GABPA (GA Binding Protein Transcription Factor, alpha Subunit 60kD, E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A) (MaxLight 550)

Sign In for Pricing
View Details
Mouse Monoclonal PACSIN3 Antibody (OTI4F8) [CoraFluor 1]
NBP2-73221CL1 0.1 mL

Mouse Monoclonal PACSIN3 Antibody (OTI4F8) [CoraFluor 1]

Sign In for Pricing
View Details