Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Xdh Rabbit Polyclonal Antibody (FITC)

Xdh Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

XOR

UniProt

P22985

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Xdh

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

146kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_058850

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAND2, ID (HAND2, BHLHA26, DHAND, Heart-and neural crest derivatives-expressed protein 2, Class A basic helix-loop-helix protein 26, Deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2) (MaxLight 750)
MBS6305392-01 0.1 mL

HAND2, ID (HAND2, BHLHA26, DHAND, Heart-and neural crest derivatives-expressed protein 2, Class A basic helix-loop-helix protein 26, Deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2) (MaxLight 750)

Sign In for Pricing
View Details
HAND2, ID (HAND2, BHLHA26, DHAND, Heart-and neural crest derivatives-expressed protein 2, Class A basic helix-loop-helix protein 26, Deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2) (MaxLight 750)
MBS6305392-02 5x 0.1 mL

HAND2, ID (HAND2, BHLHA26, DHAND, Heart-and neural crest derivatives-expressed protein 2, Class A basic helix-loop-helix protein 26, Deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2) (MaxLight 750)

Sign In for Pricing
View Details
Lentiviral mouse Rap2b shRNA (UAS) - Lentiviral mouse Rap2b shRNA (UAS, RFP) plasmid
GTR15222193 1 Vial

Lentiviral mouse Rap2b shRNA (UAS) - Lentiviral mouse Rap2b shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
MUC1 Blocking Peptide
CBP4744-01 1 mg

MUC1 Blocking Peptide

Sign In for Pricing
View Details
MUC1 Blocking Peptide
CBP4744-02 5 mg

MUC1 Blocking Peptide

Sign In for Pricing
View Details
RRM2 Polyclonal Antibody, FITC Conjugated
bs-7133R-FITC 100 µL

RRM2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details