Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCAI Rabbit Polyclonal Antibody (FITC)

SCAI Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NET40, C9orf126

UniProt

Q8N9R8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGMQESADKPTRRENPHKYLLYKPTFSQLYTFLAASFKELPANSVLLIYL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775961

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOX1 (Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, C-type Lectin Domain Family 8 Member A, Lectin-like Oxidized LDL Receptor 1, LOX-1, Lectin-like oxLDL Receptor 1, hLOX-1, Lectin-type Oxidized LDL Receptor 1, OLR1, CLEC8A) (HRP)
138086-HRP 100 µL

LOX1 (Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, C-type Lectin Domain Family 8 Member A, Lectin-like Oxidized LDL Receptor 1, LOX-1, Lectin-like oxLDL Receptor 1, hLOX-1, Lectin-type Oxidized LDL Receptor 1, OLR1, CLEC8A) (HRP)

Sign In for Pricing
View Details
1-Methyl-3- (5-methylfuran-2-yl) -1H-pyrazole-4-carbaldehyde
CWB50361-01 100 mg

1-Methyl-3- (5-methylfuran-2-yl) -1H-pyrazole-4-carbaldehyde

Sign In for Pricing
View Details
1-Methyl-3- (5-methylfuran-2-yl) -1H-pyrazole-4-carbaldehyde
CWB50361-02 1 g

1-Methyl-3- (5-methylfuran-2-yl) -1H-pyrazole-4-carbaldehyde

Sign In for Pricing
View Details
Recombinant Human Insulin-like peptide INSL5 (INSL5), partial
orb3004850-01 20 µg

Recombinant Human Insulin-like peptide INSL5 (INSL5), partial

Sign In for Pricing
View Details
Recombinant Human Insulin-like peptide INSL5 (INSL5), partial
orb3004850-02 100 µg

Recombinant Human Insulin-like peptide INSL5 (INSL5), partial

Sign In for Pricing
View Details
Recombinant Human Insulin-like peptide INSL5 (INSL5), partial
orb3004850-03 1 mg

Recombinant Human Insulin-like peptide INSL5 (INSL5), partial

Sign In for Pricing
View Details