Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHF Rabbit Polyclonal Antibody (FITC)

SHF Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q7M4L6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human SHF

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ADERISGPPASSDRLAILEDYADPFDVQETGEGSAGASGAPEKVPENDGY

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAFF antibody
70R-18354 50 ul

MAFF antibody

Sign In for Pricing
View Details
Beclin 1 HDR Plasmid (m)
sc-425033-HDR 20 µg

Beclin 1 HDR Plasmid (m)

Sign In for Pricing
View Details
CIDE-B, Human, Control Peptide (Cell death-Inducing DFF-like Effector B)
C5072-53D 50 µg

CIDE-B, Human, Control Peptide (Cell death-Inducing DFF-like Effector B)

Sign In for Pricing
View Details
1400 W
sc-3564 5 mg

1400 W

Sign In for Pricing
View Details
ATR (ataxia Telangiectasia and Rad3 Related, FRP1, MEC1, SCKL, SCKL1) (AP) discontinued
243654-AP 100 µL

ATR (ataxia Telangiectasia and Rad3 Related, FRP1, MEC1, SCKL, SCKL1) (AP) discontinued

Sign In for Pricing
View Details
Aurora A Rabbit pAb
ES20863-01 50 µL

Aurora A Rabbit pAb

Sign In for Pricing
View Details