Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHF Rabbit Polyclonal Antibody (HRP)

SHF Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

E7EWB7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SHF

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QPLPLYDTPYEPEEDGATPEGEGAPWPRESRLPEDDERPPEEYDQPWEWK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

BAG64721

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAIL (TNF Related Apoptosis Inducing Ligand, TNF-related Apoptosis-inducing Ligand TRAIL, Apo 2 Ligand, Apo2 Ligand, Apo-2 Ligand, Apo 2L, Apo2L, Apo-2L, CD253, CD253 Antigen, Protein TRAIL, TL2, Tumor Necrosis Factor (Ligand) Superfamily Member 10, TNFSF10, TNFSF10 Protein)
T8180-01G 100 µg

TRAIL (TNF Related Apoptosis Inducing Ligand, TNF-related Apoptosis-inducing Ligand TRAIL, Apo 2 Ligand, Apo2 Ligand, Apo-2 Ligand, Apo 2L, Apo2L, Apo-2L, CD253, CD253 Antigen, Protein TRAIL, TL2, Tumor Necrosis Factor (Ligand) Superfamily Member 10, TNFSF10, TNFSF10 Protein)

Sign In for Pricing
View Details
CITED1 Rabbit Polyclonal Antibody (Carrier-free)
orb3105882 100 µg

CITED1 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Lentiviral human BOD1 sgRNA gene knockout kit - Lentiviral human BOD1 sgRNA gene knockout kit (100)
GTR15384673 1 Vial

Lentiviral human BOD1 sgRNA gene knockout kit - Lentiviral human BOD1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
POLR1A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1682308 1.0 µg DNA

POLR1A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Tas1R3 Polyclonal Antibody
CAC10903-01 50 µL

Tas1R3 Polyclonal Antibody

Sign In for Pricing
View Details
Tas1R3 Polyclonal Antibody
CAC10903-02 100 µL

Tas1R3 Polyclonal Antibody

Sign In for Pricing
View Details