Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sos1 Rabbit Polyclonal Antibody (HRP)

Sos1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI449023, 9630010N06, 4430401P03Rik

UniProt

Q62245

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Sos1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YFELLKQLEEKSEDQEDKECMKQAITALLNVQSGMEKICSKSLAKRRLSE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

151kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033257

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse G-CSF R/CD114 Protein (His Tag)
PDMM100175-01 20 µg

Recombinant Mouse G-CSF R/CD114 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse G-CSF R/CD114 Protein (His Tag)
PDMM100175-02 100 µg

Recombinant Mouse G-CSF R/CD114 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse G-CSF R/CD114 Protein (His Tag)
PDMM100175-03 500 µg

Recombinant Mouse G-CSF R/CD114 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse G-CSF R/CD114 Protein (His Tag)
PDMM100175-04 1 mg

Recombinant Mouse G-CSF R/CD114 Protein (His Tag)

Sign In for Pricing
View Details
CFTR Human Gene Knockout Kit (CRISPR)
KN216476BN 1 Kit

CFTR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL-1 alpha Antibody
KC-1639-01 50 μL

IL-1 alpha Antibody

Sign In for Pricing
View Details