Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD274 Rabbit Polyclonal Antibody (HRP)

CD274 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B7-H, B7H1, PDL1, PD-L1, hPD-L1, PDCD1L1, PDCD1LG1

UniProt

Q9NZQ7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of CD274

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEE

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_054862

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMCX5 3'UTR GFP Stable Cell Line
TU051166 1.0 mL

ARMCX5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-MeCP2 Antibody
1205-MeCP2 100 µL

Anti-MeCP2 Antibody

Sign In for Pricing
View Details
Recombinant Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES)
TRV-0007171-01 10 µg

Recombinant Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES)

Sign In for Pricing
View Details
Recombinant Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES)
TRV-0007171-02 50 µg

Recombinant Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES)

Sign In for Pricing
View Details
Recombinant Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES)
TRV-0007171-03 100 µg

Recombinant Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES)

Sign In for Pricing
View Details
Recombinant Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES)
TRV-0007171-04 200 µg

Recombinant Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES)

Sign In for Pricing
View Details