Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COQ9 Rabbit Polyclonal Antibody (FITC)

COQ9 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

COQ10D5, C16orf49

UniProt

O75208

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQGGE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_064708

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coproporphyrin I Dihydrochloride (>80%) (contains Coproporphyrin lll)
TRC-C685413-50MG 50 mg

Coproporphyrin I Dihydrochloride (>80%) (contains Coproporphyrin lll)

Sign In for Pricing
View Details
Amplite® Fluorimetric Goat Anti-Mouse IgG-HRP Conjugate ELISA Assay Kit *Red Fluorescence*
11540-AAT 1000 Tests

Amplite® Fluorimetric Goat Anti-Mouse IgG-HRP Conjugate ELISA Assay Kit *Red Fluorescence*

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (N/A), CF405S conjugate, 0.1mg/mL
BNC041776-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (N/A), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Morpholinylsulfur Trifluoride
TRC-M725150-2.5G 2.5 g

4-Morpholinylsulfur Trifluoride

Sign In for Pricing
View Details
Human ADAMTS5 (A Disintegrin And Metalloproteinase With Thrombospondin 5) ELISA Kit
E-EL-H5590-01 24 Tests

Human ADAMTS5 (A Disintegrin And Metalloproteinase With Thrombospondin 5) ELISA Kit

Sign In for Pricing
View Details
Human ADAMTS5 (A Disintegrin And Metalloproteinase With Thrombospondin 5) ELISA Kit
E-EL-H5590-02 48 Tests

Human ADAMTS5 (A Disintegrin And Metalloproteinase With Thrombospondin 5) ELISA Kit

Sign In for Pricing
View Details