Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1C Rabbit Polyclonal Antibody (Biotin)

CD1C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

R7, CD1, CD1A, BDCA1

UniProt

P29017

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CD1C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPA

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_001756

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Hydroxyacylglutathione hydrolase, Mitochondrial ELISA Kit
MBS724247-01 48 Well

Guinea pig Hydroxyacylglutathione hydrolase, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Guinea pig Hydroxyacylglutathione hydrolase, Mitochondrial ELISA Kit
MBS724247-02 96 Well

Guinea pig Hydroxyacylglutathione hydrolase, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Guinea pig Hydroxyacylglutathione hydrolase, Mitochondrial ELISA Kit
MBS724247-03 5x 96 Well

Guinea pig Hydroxyacylglutathione hydrolase, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Guinea pig Hydroxyacylglutathione hydrolase, Mitochondrial ELISA Kit
MBS724247-04 10x 96 Well

Guinea pig Hydroxyacylglutathione hydrolase, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Alpha B Crystallin Rabbit Polyclonal Antibody (FITC)
orb102061 100 µL

Alpha B Crystallin Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Hepatitis B Surface Antigen (HBsAg) Antibody
ND-R0084 1 Each

Hepatitis B Surface Antigen (HBsAg) Antibody

Sign In for Pricing
View Details