Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPM2A Rabbit Polyclonal Antibody (FITC)

EPM2A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EPM2, MELF

UniProt

O95278

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human EPM2A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNENNLVDGVYCLPIG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFC4 (A1 37, A1 37kD Subunit, Activator 1 37, Activator 1 37kD Subunit, Activator 1 Subunit 4, Replication Factor C 37, Replication Factor C 37kD Subunit, Replication Factor C Subunit 4, Replication Factor C4, RF-C 37kD Subunit, RFC 37, RFC37, RFC4 replication Factor C (Activator 1) 4 37kDa, RfC4, RFC4_HUMAN, ) discontinued
225529-01 50 µL

RFC4 (A1 37, A1 37kD Subunit, Activator 1 37, Activator 1 37kD Subunit, Activator 1 Subunit 4, Replication Factor C 37, Replication Factor C 37kD Subunit, Replication Factor C Subunit 4, Replication Factor C4, RF-C 37kD Subunit, RFC 37, RFC37, RFC4 replication Factor C (Activator 1) 4 37kDa, RfC4, RFC4_HUMAN, ) discontinued

Sign In for Pricing
View Details
RFC4 (A1 37, A1 37kD Subunit, Activator 1 37, Activator 1 37kD Subunit, Activator 1 Subunit 4, Replication Factor C 37, Replication Factor C 37kD Subunit, Replication Factor C Subunit 4, Replication Factor C4, RF-C 37kD Subunit, RFC 37, RFC37, RFC4 replication Factor C (Activator 1) 4 37kDa, RfC4, RFC4_HUMAN, ) discontinued
225529-02 100 µL

RFC4 (A1 37, A1 37kD Subunit, Activator 1 37, Activator 1 37kD Subunit, Activator 1 Subunit 4, Replication Factor C 37, Replication Factor C 37kD Subunit, Replication Factor C Subunit 4, Replication Factor C4, RF-C 37kD Subunit, RFC 37, RFC37, RFC4 replication Factor C (Activator 1) 4 37kDa, RfC4, RFC4_HUMAN, ) discontinued

Sign In for Pricing
View Details
Recombinant Fibulin 5 Antibody
RC-15185-01 50 μL

Recombinant Fibulin 5 Antibody

Sign In for Pricing
View Details
Recombinant Fibulin 5 Antibody
RC-15185-02 100 µL

Recombinant Fibulin 5 Antibody

Sign In for Pricing
View Details
Recombinant Fibulin 5 Antibody
RC-15185-03 1 mL

Recombinant Fibulin 5 Antibody

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), 0.2mg/mL
BNUB0018-500 1x 500 µL

Human Kappa Light Chain (L1C1), 0.2mg/mL

Sign In for Pricing
View Details