Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGR Rabbit Polyclonal Antibody (HRP)

RGR Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RP44

UniProt

P47804

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLLRVSHRRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRYHHYCTRS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002912

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HisRS Rabbit Polyclonal Antibody
APRab12040-01 20 µL

HisRS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HisRS Rabbit Polyclonal Antibody
APRab12040-02 50 µL

HisRS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HisRS Rabbit Polyclonal Antibody
APRab12040-03 100 µL

HisRS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HisRS Rabbit Polyclonal Antibody
APRab12040-04 200 µL

HisRS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human DAZL shRNA (UAS) - Lentiviral human DAZL shRNA (UAS, iRFP) plasmid
GTR15116116 1 Vial

Lentiviral human DAZL shRNA (UAS) - Lentiviral human DAZL shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
C-Abl (ABL1, v-abl, Abelson Murine Leukemia Viral Oncogene Homolog 1, ABL, c-ABL, JTK7, p150, Proto-Oncogene Tyrosine-Protein Kanase ABL1, v-abl) (BSA & Azide Free) (APC) discontinued
C0013-02AX-APC 100 µL

C-Abl (ABL1, v-abl, Abelson Murine Leukemia Viral Oncogene Homolog 1, ABL, c-ABL, JTK7, p150, Proto-Oncogene Tyrosine-Protein Kanase ABL1, v-abl) (BSA & Azide Free) (APC) discontinued

Sign In for Pricing
View Details