Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRMS Rabbit Polyclonal Antibody (HRP)

SRMS Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SRM, PTK70, C20orf148, dJ697K14.1

UniProt

Q9H3Y6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of SRMS

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAIHRC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_543013

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Transcriptional repressor protein YY1 (YY1) ELISA Kit
MBS286611-01 48 Tests

Mouse Transcriptional repressor protein YY1 (YY1) ELISA Kit

Sign In for Pricing
View Details
Mouse Transcriptional repressor protein YY1 (YY1) ELISA Kit
MBS286611-02 96 Tests

Mouse Transcriptional repressor protein YY1 (YY1) ELISA Kit

Sign In for Pricing
View Details
Mouse Transcriptional repressor protein YY1 (YY1) ELISA Kit
MBS286611-03 5x 96 Tests

Mouse Transcriptional repressor protein YY1 (YY1) ELISA Kit

Sign In for Pricing
View Details
Mouse Transcriptional repressor protein YY1 (YY1) ELISA Kit
MBS286611-04 10x 96 Tests

Mouse Transcriptional repressor protein YY1 (YY1) ELISA Kit

Sign In for Pricing
View Details
RALB Rabbit Monoclonal Antibody
AMRe02518-01 50 µL

RALB Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
RALB Rabbit Monoclonal Antibody
AMRe02518-02 100 µL

RALB Rabbit Monoclonal Antibody

Sign In for Pricing
View Details